Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Protein FAM19A5(FAM19A5)

Recombinant Bovine Protein FAM19A5(FAM19A5)

SKU:CSB-CF676973BO

Regular price €1.404,95 EUR
Regular price Sale price €1.404,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q3ZBS2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIRTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS

Protein Names:Recommended name: Protein FAM19A5 Alternative name(s): Chemokine-like protein TAFA-5

Gene Names:Name:FAM19A5 Synonyms:TAFA5

Expression Region:1-132

Sequence Info:full length protein

View full details