Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Pregnancy-associated protein bPAP

Recombinant Bovine Pregnancy-associated protein bPAP

SKU:CSB-EP307176BO

Regular price €776,95 EUR
Regular price Sale price €776,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bos taurus (Bovine)

Delivery time: 3-7 business days

Uniprot ID: P84291

AA Sequence: DSELAGPRGARGPHGLSGPHGLSGLSGPSGYTGPIGMSGLTGLRREESEKVWLESKDGQELELVSSGSAQEELELVSSGSAQVSFASYLGASQPLPSELW

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-100aa

Protein length: Full Length

MW: 17.3 kDa

Alternative Name(s):

Relevance:

Reference: "Characterization of a bovine pregnancy-associated protein using two-dimensional gel electrophoresis, N-terminal sequencing and mass spectrometry." Pyo J., Hwang S.-I., Oh J., Lee S.-J., Kang S.-C., Kim J.-S., Lim J. Proteomics 3:2420-2427(2003)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details