Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2)

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2)

SKU:CSB-CF015659BO

Regular price €1.394,95 EUR
Regular price Sale price €1.394,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q02827

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMTGRQGRATFQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLAGLHR QLLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYGEVFEEFHPVR

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b

Gene Names:Name:NDUFC2

Expression Region:1-120

Sequence Info:Full length protein

View full details