Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Myelin protein P0(MPZ)

Recombinant Bovine Myelin protein P0(MPZ)

SKU:CSB-CF014774BO

Regular price €1.500,95 EUR
Regular price Sale price €1.500,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P10522

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AIVVYTDKEVHGAVGSQVTLYCSFWSSEWVSDDLSFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPHRKDGSIVIHNLDYGDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLALLLFYLIRYCWLRRQAALQRRLSAMEKGKLHKTAKDASKRGRQTPVLYAMLDHSRSTKAASEKKTKGLGESRKDKK

Protein Names:Recommended name: Myelin protein P0 Alternative name(s): Myelin peripheral protein Short name= MPP Myelin protein zero

Gene Names:Name:MPZ

Expression Region:29-248

Sequence Info:full length protein

View full details