Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Mitochondrial import receptor subunit TOM20 homolog(TOMM20)

Recombinant Bovine Mitochondrial import receptor subunit TOM20 homolog(TOMM20)

SKU:CSB-CF024046BO

Regular price €1.424,95 EUR
Regular price Sale price €1.424,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6H7B1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Protein Names:Recommended name: Mitochondrial import receptor subunit TOM20 homolog Alternative name(s): Mitochondrial 20 kDa outer membrane protein Outer mitochondrial membrane receptor Tom20

Gene Names:Name:TOMM20

Expression Region:1-145

Sequence Info:full length protein

View full details