Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Metalloproteinase inhibitor 4(TIMP4)

Recombinant Bovine Metalloproteinase inhibitor 4(TIMP4)

SKU:CSB-EP023563BO

Regular price €910,95 EUR
Regular price Sale price €910,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O97563

Gene Names: TIMP4

Organism: Bos taurus (Bovine)

AA Sequence: CSCAPAHPQQHVCHSALAIRAKISSEKVVPASTDPADPQKMIRYEIKQIKMFKGFEKVNDIQYIYTPFDSSLCGVKLEANSQKRYLLTGQILSDGKVFVHLCNYIEPWENLSFLQRESLNHHYHLNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGSCSWYQGRLPLRKEFVDIIQP

Expression Region: 30-224aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 26.5 kDa

Alternative Name(s): Tissue inhibitor of metalloproteinases 4 ;TIMP-4

Relevance: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor.

Reference: NIH - Mammalian Gene Collection (MGC) project

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details