Gene Bio Systems
Recombinant Bovine FXYD domain-containing ion transport regulator 7(FXYD7)
Recombinant Bovine FXYD domain-containing ion transport regulator 7(FXYD7)
SKU:CSB-CF670248BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q3ZBJ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATQVPTKVPQDPDPFYYDYDTVQTVGMTLATILFLLGILIILSKKVKCRKADSRSESPT CKSCKSELPSSAPGGGGV
Protein Names:Recommended name: FXYD domain-containing ion transport regulator 7
Gene Names:Name:FXYD7
Expression Region:1-78
Sequence Info:full length protein