Gene Bio Systems
Recombinant Bovine Cytochrome c oxidase subunit 6A2, mitochondrial(COX6A2)
Recombinant Bovine Cytochrome c oxidase subunit 6A2, mitochondrial(COX6A2)
SKU:CSB-CF005849BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P07471
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPF SWGDGNHTFFHNPRVNPLPTGYEKP
Protein Names:Recommended name: Cytochrome c oxidase subunit 6A2, mitochondrial Alternative name(s): Cytochrome c oxidase polypeptide VIa-heart Short name= COXVIAH Cytochrome c oxidase polypeptide VIb
Gene Names:Name:COX6A2 Synonyms:COX6A
Expression Region:13-97
Sequence Info:Full length protein
