Gene Bio Systems
Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)
Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)
SKU:CSB-CF005832BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P00423
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELY RLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQT KRMLDMKVAPIQGFSAKWDYDKNEWKK
Protein Names:Recommended name: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Alternative name(s): Cytochrome c oxidase polypeptide IV Cytochrome c oxidase subunit IV isoform 1 Short name= COX IV-1
Gene Names:Name:COX4I1 Synonyms:COX4
Expression Region:23-169
Sequence Info:Full length protein
