Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine coronavirus Spike glycoprotein(S),partial

Recombinant Bovine coronavirus Spike glycoprotein(S),partial

SKU:CSB-EP322803BJK

Regular price €870,95 EUR
Regular price Sale price €870,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P15777

Gene Names: S

Organism: Bovine coronavirus (strain Mebus) (BCoV) (BCV)

AA Sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT

Expression Region: 326-540aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

MW: 27.2 kDa

Alternative Name(s): E2 Peplomer protein

Relevance: S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection. S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes

Reference: "Deduced sequence of the bovine coronavirus spike protein and identification of the internal proteolytic cleavage site." Abraham S., Kienzle T.E., Lapps W.E., Brian D.A. Virology 176:296-301(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details