Recombinant Bovine coronavirus Spike glycoprotein(S),partial

Recombinant Bovine coronavirus Spike glycoprotein(S),partial

CSB-EP322803BJK
Regular price
€632,95 EUR
Sale price
€632,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Microbiology

Target / Protein: S

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bovine coronavirus (strain Mebus) (BCoV) (BCV)

Delivery time: 3-7 business days

Uniprot ID: P15777

AA Sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT

Tag info: N-terminal 10xHis-tagged

Expression Region: 326-540aa

Protein length: Partial

MW: 27.2 kDa

Alternative Name(s): E2 Peplomer protein

Relevance: S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection. S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes

Reference: "Deduced sequence of the bovine coronavirus spike protein and identification of the internal proteolytic cleavage site." Abraham S., Kienzle T.E., Lapps W.E., Brian D.A. Virology 176:296-301(1990)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share