Gene Bio Systems
Recombinant Bovine coronavirus Envelope small membrane protein(E)
Recombinant Bovine coronavirus Envelope small membrane protein(E)
SKU:CSB-CF366295BJE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV)
Uniprot NO.:P0C2Q1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFMADAYFADTVWYVGQIIFIVAICLLVIIVVVAFLATFKLCIQLCGMCNTLVLSPSIYV FNRGRQFYEFYNDVKPPVLDVDDV
Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein
Gene Names:Name:E Synonyms:sM ORF Names:5b
Expression Region:1-84
Sequence Info:full length protein
