Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Coiled-coil domain-containing transmembrane protein C7orf53 homolog

Recombinant Bovine Coiled-coil domain-containing transmembrane protein C7orf53 homolog

SKU:CSB-CF401439BO

Regular price €1.415,95 EUR
Regular price Sale price €1.415,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A5PK14

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKRSSQDSGSRSIPEDRKLYVVDSINDLNKLNLCPAGSQQLFPLEEKLQDISTDSGNGSR SLFLVGLIIVLIISLALVSFVIFLIVQTENKMEDVSRRLAAEGKDIDDLKKINSIIVKRL NQLDSEQS

Protein Names:Recommended name: Coiled-coil domain-containing transmembrane protein C7orf53 homolog

Gene Names:

Expression Region:1-128

Sequence Info:full length protein

View full details