Gene Bio Systems
Recombinant Bovine CD99 antigen-like protein 2(CD99L2)
Recombinant Bovine CD99 antigen-like protein 2(CD99L2)
SKU:CSB-CF004975BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A1A4K1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DTGGFRLEDAVEGTSSVKQRWDHVTTTTRRPGATRAPAKPAGPPAEDDFNLADALDDQNDRDHDRKKPSIGGGGFSDKDLEDIVGGGDYKPDKGKGGGQYGGGDNSDDSGMSAETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSALQTQSTEPPPPEPPRI
Protein Names:Recommended name: CD99 antigen-like protein 2 Alternative name(s): CD_antigen= CD99
Gene Names:Name:CD99L2
Expression Region:26-217
Sequence Info:full length protein
