Gene Bio Systems
Recombinant Botryotinia fuckeliana Assembly factor cbp4(cbp4)
Recombinant Botryotinia fuckeliana Assembly factor cbp4(cbp4)
SKU:CSB-CF412479BVD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)
Uniprot NO.:A6SAY2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPPKPTNWRMYGKMAVAGLTCCVGGPALIYYISPTEEELFLKYNPELQKRSLENRVGKQE DFDNFVARLKEYSKSDRPIWVEAEEAARKKRSGKIEEQAKLMQEMQQRKEEIKKSGTNLM PGGSL
Protein Names:Recommended name: Assembly factor cbp4 Alternative name(s): Cytochrome b mRNA-processing protein 4
Gene Names:Name:cbp4 ORF Names:BC1G_09937
Expression Region:1-125
Sequence Info:full length protein
