Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlB homolog(ptlB)

Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlB homolog(ptlB)

SKU:CSB-CF763713BTY

Regular price €1.386,95 EUR
Regular price Sale price €1.386,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)

Uniprot NO.:Q7WDU2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRQRLRKP

Protein Names:Recommended name: Type IV secretion system protein ptlB homolog

Gene Names:Name:ptlB Ordered Locus Names:BB4896

Expression Region:1-104

Sequence Info:full length protein

View full details