Skip to product information
1 of 1

Gene Bio Systems

Recombinant Blattabacterium sp. subsp. Periplaneta americana Sec-independent protein translocase protein TatC(tatC)

Recombinant Blattabacterium sp. subsp. Periplaneta americana Sec-independent protein translocase protein TatC(tatC)

SKU:CSB-CF509864BTK

Regular price €1.556,95 EUR
Regular price Sale price €1.556,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Blattabacterium sp. subsp. Periplaneta americana (strain BPLAN) (Periplaneta americana symbiotic bacterium)

Uniprot NO.:D0J948

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNEKNEMPFWEHIEELRKHLIHSVCAMIIATIILMNNKNVIFDYILFGPAKTDFITYRL FHKLGKIFHRSHHSFYFFSHNLEIQNRQIFGQFNIYVWTCFIGGFILSFPYIFYEFWKFI KPALSDEERKYSRGIIMMVTFLFILGVLFGYFILCPFLIHFGYTFRISSFPRNIFDLSDY ISLIMHSILSMGITFLFPIFIYFLTKIELISYPFLKKYRKHAFLILLILASAITPGDIFS TIVVLIPLMILYQFSIYISFYVSKKK

Protein Names:Recommended name: Sec-independent protein translocase protein TatC

Gene Names:Name:tatC Ordered Locus Names:BPLAN_242

Expression Region:1-266

Sequence Info:full length protein

View full details