Skip to product information
1 of 1

Gene Bio Systems

Recombinant Biofilm PGA synthesis protein PgaD(pgaD)

Recombinant Biofilm PGA synthesis protein PgaD(pgaD)

SKU:CSB-CF301663EOD

Regular price €1.421,95 EUR
Regular price Sale price €1.421,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P69433

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT SQGQIKMVVSEKALVRA

Protein Names:Recommended name: Biofilm PGA synthesis protein PgaD

Gene Names:Name:pgaD Ordered Locus Names:Z1523, ECs1267

Expression Region:1-137

Sequence Info:full length protein

View full details