Skip to product information
1 of 1

Gene Bio Systems

Recombinant Beta-carotene 3-hydroxylase, chloroplastic(CRTZ)

Recombinant Beta-carotene 3-hydroxylase, chloroplastic(CRTZ)

SKU:CSB-CF865945HBAF

Regular price €1.352,95 EUR
Regular price Sale price €1.352,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Haematococcus pluvialis

Uniprot NO.:Q9SPK6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HDGLVHRRFPTGPIAGLPYMKRLTVAHQLHHSGKYGGAPWGMFLGPQEL QHIPGAAEEVERLVLELDWSKR

Protein Names:Recommended name: Beta-carotene 3-hydroxylase, chloroplastic EC= 1.14.13.129

Gene Names:Name:CRTZ

Expression Region:252-322

Sequence Info:full length protein

View full details