Skip to product information
1 of 1

Gene Bio Systems

Recombinant Beet necrotic yellow vein virus Movement protein TGB3

Recombinant Beet necrotic yellow vein virus Movement protein TGB3

SKU:CSB-CF737464BSO

Regular price €1.414,95 EUR
Regular price Sale price €1.414,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Beet necrotic yellow vein virus (isolate Japan/S) (BNYVV)

Uniprot NO.:Q65676

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVLVVKVDLSNIVLYIVAGCVVVSMLYSPFFSNDVKASSYAGAVFKGSGCIMDRNSFAQF GSCDIPKHVAESITKVATKEHDADIMVKRGEVTVRVVTLTETLFIILSRLFGLAVFLFMI CLMSIVWFWCHR

Protein Names:Recommended name: Movement protein TGB3 Alternative name(s): 15 kDa protein P15 Triple gene block 3 protein Short name= TGBp3

Gene Names:

Expression Region:1-132

Sequence Info:full length protein

View full details