Recombinant Beet necrotic yellow vein virus  Movement protein TGB2

Recombinant Beet necrotic yellow vein virus Movement protein TGB2

CSB-CF717651BSO
Regular price
€1.006,95 EUR
Sale price
€1.006,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Beet necrotic yellow vein virus (isolate Japan/S) (BNYVV)

Uniprot NO.:Q65675

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHSGGDYGVPTFSNGGKYRDGTRS ADFNSNNHRAYGCGGSGGSVSSRVGQQLVVLAIVSVLIVSLLQRLRSPPEHICNGACG

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 13 kDa protein P13 Triple gene block 2 protein Short name= TGBp2

Gene Names:

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share