Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus 279-2005 Envelope small membrane protein(E)

Recombinant Bat coronavirus 279-2005 Envelope small membrane protein(E)

SKU:CSB-CF608125BFB

Regular price €1.349,95 EUR
Regular price Sale price €1.349,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus 279/2005 (BtCoV) (BtCoV/279/2005)

Uniprot NO.:Q0Q473

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYSFVSEETGTLIVNSVLLFFAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein

Gene Names:Name:E Synonyms:sM ORF Names:4

Expression Region:1-76

Sequence Info:full length protein

View full details