Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacteroides vulgatus UPF0059 membrane protein BVU_2631 (BVU_2631)

Recombinant Bacteroides vulgatus UPF0059 membrane protein BVU_2631 (BVU_2631)

SKU:CSB-CF405207BOP

Regular price €1.479,95 EUR
Regular price Sale price €1.479,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154)

Uniprot NO.:A6L3M0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTLEIWLLAISLAMDCFTVSITSGIIMRRICWRTFFIMAFFFGLFQAVMPLIGWFAASR FSHLIEDYDHWIAFGLLAFWGGRMIKESFSNEDKRCFDPTKLKVVVTLAIATSIDALAIG ISFAFVGINSFTSILSPIVIIGFTSFVISTLGSLIGVFCGKRFNLRMELWGGLVLIIIGV KILIEHLFLS

Protein Names:Recommended name: UPF0059 membrane protein BVU_2631

Gene Names:Ordered Locus Names:BVU_2631

Expression Region:1-190

Sequence Info:full length protein

View full details