Recombinant Bacteroides fragilis Fragilysin(btfP)

Recombinant Bacteroides fragilis Fragilysin(btfP)

CSB-EP346537BDP
Regular price
€743,95 EUR
Sale price
€743,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: btfP

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bacteroides fragilis

Delivery time: 3-7 business days

Uniprot ID: P54355

AA Sequence: ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 26-405aa

Protein length: Full Length

MW: 58.6 kDa

Alternative Name(s): Enterotoxin

Relevance: Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.

Reference: "Cloning and characterization of the gene for the metalloprotease enterotoxin of Bacteroides fragilis."Kling J.J., Wright R.L., Moncrief J.S., Wilkins T.D.FEMS Microbiol. Lett. 146:279-284(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share