Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis UPF0700 transmembrane protein yoaK(yoaK)

Recombinant Bacillus subtilis UPF0700 transmembrane protein yoaK(yoaK)

SKU:CSB-CF516475BRJ

Regular price €1.503,95 EUR
Regular price Sale price €1.503,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O34343

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAAAYRNTLLSLLCLTAGIVDVIGYLSLGHVFTANMTGNIVLLGLAIGKSIQVTVFNSL TALIGFICGVIIATLMVGKAENTLWPSAVTKALALEAFILFVFACLSFYRAFVPVHILII LMSISMGIQTTAAKKLGIAGISSTVLTGTLASLLEDISGRLFFKKQKKTFLRDTVLRALA IILYCVGAIIVALAEPDFYHFIIWVPIVLIFGIMMTAKLKLSGEK

Protein Names:Recommended name: UPF0700 transmembrane protein yoaK

Gene Names:Name:yoaK Ordered Locus Names:BSU18640

Expression Region:1-225

Sequence Info:full length protein

View full details