Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis UPF0603 protein ydjH(ydjH)

Recombinant Bacillus subtilis UPF0603 protein ydjH(ydjH)

SKU:CSB-CF518565BRJ

Regular price €1.507,95 EUR
Regular price Sale price €1.507,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O35004

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SELQQHVYDRAHLLSKAEIGKLESLSAKLGAKRDTDFIIITTKSTNGEDIADYTGDFYDR YGKGSTAILTIDMTNREVFIAGFKKAEQYLDNSRLNSIRNTISSDLSNENYFEAFETYIQ LSYKDMGIKPGVNPDNIFFTWWFQLIAAIAVGGIAVSIMLYHAGGKVTVNGSTYMDQRTS DVIDQYDTYIRTTVTRERKPSDKDSGSDGGVTKGGTSYSGSRGSF

Protein Names:Recommended name: UPF0603 protein ydjH

Gene Names:Name:ydjH Ordered Locus Names:BSU06200

Expression Region:30-254

Sequence Info:full length protein

View full details