Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein ypbD(ypbD)

Recombinant Bacillus subtilis Uncharacterized protein ypbD(ypbD)

SKU:CSB-CF343877BRJ

Regular price €1.463,95 EUR
Regular price Sale price €1.463,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P50730

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTQLLIIFAAAAAGLFFFEDVRDVLKLWDIRDMRIIWYGVSIAVIVILADMAVMKWFPSH LYDDGGINKKIFSKRSIPHIIFLTLLIAFAEEMLFRGVLQTHIGLWTASLIFAALHFRYL SKWLLFIMVTAISFLLGLMYEWTGNLFVPMTAHFIIDAVFACQIRFEHVRRDKHDEHVES REKKSPESL

Protein Names:Recommended name: Uncharacterized protein ypbD

Gene Names:Name:ypbD Ordered Locus Names:BSU23010

Expression Region:1-189

Sequence Info:full length protein

View full details