Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein YnaB(ynaB)

Recombinant Bacillus subtilis Uncharacterized protein YnaB(ynaB)

SKU:CSB-EP309046BRJ

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P94480

Gene Names: ynaB

Organism: Bacillus subtilis (strain 168)

AA Sequence: MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE

Expression Region: 1-144aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 32.8 kDa

Alternative Name(s):

Relevance:

Reference: "The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details