Recombinant Bacillus subtilis  Sporulation protein yjcA(yjcA)

Recombinant Bacillus subtilis Sporulation protein yjcA(yjcA)

CSB-CF523281BRJ
Regular price
€1.018,95 EUR
Sale price
€1.018,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O31623

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVINGLTIVLLSLAVFRLARLLVFDTIMAPLRSLFHEEKEEKDADGNIETYIVIKGTGVR AFIGELLSCYWCTGVWCAGFLILCQAVIPQAAQWLILLLAIAGLAGIIETLVSKWLQE

Protein Names:Recommended name: Sporulation protein yjcA

Gene Names:Name:yjcA Ordered Locus Names:BSU11790

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share