Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Small basic protein(sbp)

Recombinant Bacillus subtilis Small basic protein(sbp)

SKU:CSB-CF338906BRJ

Regular price €1.402,95 EUR
Regular price Sale price €1.402,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P28265

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV I

Protein Names:Recommended name: Small basic protein

Gene Names:Name:sbp Ordered Locus Names:BSU15270

Expression Region:1-121

Sequence Info:full length protein

View full details