Gene Bio Systems
Recombinant Bacillus subtilis Rod shape-determining protein mreD(mreD)
Recombinant Bacillus subtilis Rod shape-determining protein mreD(mreD)
SKU:CSB-CF311530BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:Q01467
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKRFLLPFVMMLVFSAESIFTDLVHFPFVTDDQVLAPRFLMLVLIFMSAFINQKHAMIYG FIFGFLYDMNYTSLLGVYMFGFAGLCYLASKAFKVLHTNAFVVILIAVLAVCLLEFYVFG IQSLIHKDIMTFNGFVLDRFIPTILLNIAAALILVLPFRLFFMSLKKELRDE
Protein Names:Recommended name: Rod shape-determining protein mreD
Gene Names:Name:mreD Synonyms:rodB Ordered Locus Names:BSU28010
Expression Region:1-172
Sequence Info:full length protein
