
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O07533
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEFVQYACNGAVAEIILNRPDAHHALNEQMLSELKEAVEMAAASEALIVLLRGSGKGFSA GGDIRMMTSEHDPDQFKRLMDTIEAVTLNLYQMKKVTIAAIHGAAAGLGLSLALCADIVL AEKNAVLAMNFIGIGLVPDGGGHYLLKKRIGEAKAKKLIWSGKKLSASEAADMGLLDGTF AGDPAEGARPIIETLLASPLLAMIETKGIFQSLQIEELKKVLSLERSAQERMRRTKDHQE GIRAFLEKREPKFQA
Protein Names:Recommended name: Putative enoyl-CoA hydratase/isomerase yhaR
Gene Names:Name:yhaR Ordered Locus Names:BSU09880
Expression Region:1-255
Sequence Info:full length protein
You may also like
-
Recombinant Bacillus subtilis Uncharacterized transporter YwrA(ywrA)
- Regular price
- €1.314,95 EUR
- Sale price
- €1.314,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Uncharacterized protein yqjA(yqjA)
- Regular price
- €1.445,95 EUR
- Sale price
- €1.445,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Putative efflux system component yhbJ(yhbJ)
- Regular price
- €1.352,95 EUR
- Sale price
- €1.352,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Uncharacterized protein ydjG(ydjG)
- Regular price
- €1.462,95 EUR
- Sale price
- €1.462,95 EUR
- Regular price
-
- Unit price
- per
Sold out