
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O05227
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLW FVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKE DSYL
Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G Alternative name(s): Mrp complex subunit G Multiple resistance and pH homeostasis protein G
Gene Names:Name:mrpG Synonyms:yufB Ordered Locus Names:BSU31660
Expression Region:1-124
Sequence Info:full length protein
You may also like
-
Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit C
- Regular price
- €1.025,95 EUR
- Sale price
- €1.025,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit F
- Regular price
- €1.011,95 EUR
- Sale price
- €1.011,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit B
- Regular price
- €1.048,95 EUR
- Sale price
- €1.048,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit E(mrpE)
- Regular price
- €1.059,95 EUR
- Sale price
- €1.059,95 EUR
- Regular price
-
- Unit price
- per
Sold out