Gene Bio Systems
Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit F
Recombinant Bacillus subtilis Na(+)-H(+) antiporter subunit F
SKU:CSB-CF520819BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O05228
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFTLILQIALGIMAVSTFLYVIRVIKGPTVPDRVVALDAIGINLIAITALVSILLKTSAF LDIILLLGILSFIGTIAFSKFLEKGEIIENDRNR
Protein Names:Recommended name: Na(+)/H(+) antiporter subunit F Alternative name(s): Mrp complex subunit F Multiple resistance and pH homeostasis protein F Sodium-cholate efflux protein MrpF
Gene Names:Name:mrpF Synonyms:yufC Ordered Locus Names:BSU31650
Expression Region:1-94
Sequence Info:full length protein
