Gene Bio Systems
Recombinant Bacillus licheniformis UPF0060 membrane protein BLi00854-BL03049(BLi00854, BL03049)
Recombinant Bacillus licheniformis UPF0060 membrane protein BLi00854-BL03049(BLi00854, BL03049)
SKU:CSB-CF714662BQU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus licheniformis (strain DSM 13 / ATCC 14580)
Uniprot NO.:Q65MC6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMIAIGLFLLAGLAEIAGGYLVWLWLRESKPLWYGLAGGLTLIIYGVIPAFQAFPSFGRV YAAYGGVFIILAVLWGWLVDKKTPDLYDWAGAVICLAGVSVMLWAPRG
Protein Names:Recommended name: UPF0060 membrane protein BLi00854/BL03049
Gene Names:Ordered Locus Names:BLi00854, BL03049
Expression Region:1-108
Sequence Info:full length protein
