Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0756 membrane protein BCB4264_A4705 (BCB4264_A4705)

Recombinant Bacillus cereus UPF0756 membrane protein BCB4264_A4705 (BCB4264_A4705)

SKU:CSB-CF472186BQO

Regular price €1.434,95 EUR
Regular price Sale price €1.434,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain B4264)

Uniprot NO.:B7HFA9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TVIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK

Protein Names:Recommended name: UPF0756 membrane protein BCB4264_A4705

Gene Names:Ordered Locus Names:BCB4264_A4705

Expression Region:1-153

Sequence Info:full length protein

View full details