Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0059 membrane protein BCAH820_5416 (BCAH820_5416)

Recombinant Bacillus cereus UPF0059 membrane protein BCAH820_5416 (BCAH820_5416)

SKU:CSB-CF476547BQM

Regular price €1.466,95 EUR
Regular price Sale price €1.466,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain AH820)

Uniprot NO.:B7JGQ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI

Protein Names:Recommended name: UPF0059 membrane protein BCAH820_5416

Gene Names:Ordered Locus Names:BCAH820_5416

Expression Region:1-182

Sequence Info:full length protein

View full details