Gene Bio Systems
Recombinant Bacillus cereus subsp. cytotoxis UPF0295 protein Bcer98_0460 (Bcer98_0460)
Recombinant Bacillus cereus subsp. cytotoxis UPF0295 protein Bcer98_0460 (Bcer98_0460)
SKU:CSB-CF416822BOK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus cereus subsp. cytotoxis (strain NVH 391-98)
Uniprot NO.:A7GL07
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIKYSNKINKIRTFALSLVFIGLLIAYLGVFFRENIIIMTTFMMLGFLAVLASTFVYFW IGMLSTKTVQIVCPSCNKPTKMLGRVDVCMHCNQPLTLDSNLEGKEFDEKYNKKTIKHTN IYK
Protein Names:Recommended name: UPF0295 protein Bcer98_0460
Gene Names:Ordered Locus Names:Bcer98_0460
Expression Region:1-123
Sequence Info:full length protein
