Gene Bio Systems
Recombinant Bacillus cereus Methylglyoxal synthase(mgsA)
Recombinant Bacillus cereus Methylglyoxal synthase(mgsA)
SKU:CSB-EP507015BQK
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: C1EN30
Gene Names: mgsA
Organism: Bacillus cereus (strain 03BB102)
AA Sequence: MKIALIAHDKKKDDMVSFAYAYKPIFEQHELFATGTTGLRIMEATGLVVTRYQSGPLGGDQEIGAMIAKNDLDMVIFFRDPLTAQPHEPDVNALLRLCDVYAIPLATNMASAEMLMHALERGDLDYRKLRK
Expression Region: 1-131aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 30.7 kDa
Alternative Name(s):
Relevance:
Reference: "Genome sequence of Bacillus cereus 03BB102."Dodson R.J., Jackson P., Munk A.C., Brettin T., Bruce D., Detter C., Tapia R., Han C., Sutton G., Sims D.Submitted (FEB-2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
