Gene Bio Systems
Recombinant Bacillus cereus Holin-like protein CidA(cidA)
Recombinant Bacillus cereus Holin-like protein CidA(cidA)
SKU:CSB-CF481867BQO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus cereus (strain B4264)
Uniprot NO.:B7HCE7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKWWKLSGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYRDTLTQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGST Q
Protein Names:Recommended name: Holin-like protein CidA
Gene Names:Name:cidA Ordered Locus Names:BCB4264_A3777
Expression Region:1-121
Sequence Info:full length protein
