Gene Bio Systems
Recombinant Bacillus anthracis UPF0756 membrane protein BAA_4851 (BAA_4851)
Recombinant Bacillus anthracis UPF0756 membrane protein BAA_4851 (BAA_4851)
SKU:CSB-CF503573BQF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis (strain A0248)
Uniprot NO.:C3PAI4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK
Protein Names:Recommended name: UPF0756 membrane protein BAA_4851
Gene Names:Ordered Locus Names:BAA_4851
Expression Region:1-153
Sequence Info:full length protein
