Gene Bio Systems
Recombinant Azotobacter vinelandii UPF0114 protein Avin_40830 (Avin_40830)
Recombinant Azotobacter vinelandii UPF0114 protein Avin_40830 (Avin_40830)
SKU:CSB-CF507658DPY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Uniprot NO.:C1DEB0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERFLENAMYASRWLLAPIYIGLSVALLALTLKFFQEVYHLLPHVLEMAEAELILVLLSM IDMALVGGLLVMVMISGYENFVSQLDIDEGKEKLDWLGKMDSGSLKLKVAASIVAISSIH LLRVFMDAQKIPNDKLLWYVLIHMTFVVSAFVMSYLEKMAKHAH
Protein Names:Recommended name: UPF0114 protein Avin_40830
Gene Names:Ordered Locus Names:Avin_40830
Expression Region:1-164
Sequence Info:full length protein
