Skip to product information
1 of 1

Gene Bio Systems

Recombinant Azoarcus sp. Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

Recombinant Azoarcus sp. Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

SKU:CSB-CF375697AVL

Regular price €1.511,95 EUR
Regular price Sale price €1.511,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Azoarcus sp. (strain BH72)

Uniprot NO.:A1K3B8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTLWRWLGRALLAAFALLLLWQVWLFAQVAWWRTHNPDSTSFMRLRLDALQEKKPDARL RHTWVPYEQISIHLKRAVVAAEDDGFVDHEGFDWDGIQRALEKNERKGRPVSGGSTISQQ LAKNLFLSPSRSYFRKAQEAVITVMIEQLWSKRRILEVYLNVVEWGNGIFGAEAAARRYY GLPASRLGPAEAARLAVMLPNPRKYERSFGPRLAAHADRIRGRMAWAEVPP

Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.-

Gene Names:Name:mtgA Ordered Locus Names:azo0706

Expression Region:1-231

Sequence Info:full length protein

View full details