Gene Bio Systems
Recombinant ATP synthase subunit a(atp6)
Recombinant ATP synthase subunit a(atp6)
SKU:CSB-CF015070APK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aspergillus amstelodami
Uniprot NO.:P00853
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGNLNFVLSPLDQFEVRDLLSINANLLGNFHLSLTNIGLYLTIGIFLILTYSLLATNNNK IIPNNWSISQESIYATVH
Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6
Gene Names:Name:atp6
Expression Region:1-78
Sequence Info:full length protein
