Gene Bio Systems
Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)
Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)
SKU:CSB-CF427472CXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis briggsae
Uniprot NO.:A8XDX2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL
Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATPase protein 9 ATPase subunit c
Gene Names:ORF Names:CBG11706
Expression Region:25-116
Sequence Info:full length protein
