Skip to product information
1 of 1

Gene Bio Systems

Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)

Recombinant ATP synthase lipid-binding protein, mitochondrial (CBG11706)

SKU:CSB-CF427472CXX

Regular price €1.374,95 EUR
Regular price Sale price €1.374,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:A8XDX2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL

Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATPase protein 9 ATPase subunit c

Gene Names:ORF Names:CBG11706

Expression Region:25-116

Sequence Info:full length protein

View full details