Gene Bio Systems
Recombinant Aspergillus oryzae Protein sym1(sym1)
Recombinant Aspergillus oryzae Protein sym1(sym1)
SKU:CSB-CF651928DPA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Uniprot NO.:Q2TXA2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFRWYQAKLAKQPILTASVTSAVLFGSGDVLAQQVVDRKGLEKHDFARTGRMALYGGAIF GPAATTWFGFLQRNVVLKNSKATIVARVAADQCLFTPTHLTCFLTSMAIMEGSDPIEKWR NSFLPSYKANLTIWPLVQGVNFSIVPLEYRVLVVNLVSLGWNCLLSMINSGDK
Protein Names:Recommended name: Protein sym1
Gene Names:Name:sym1 ORF Names:AO090010000224
Expression Region:1-173
Sequence Info:full length protein
