Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ashbya gossypii Microsomal signal peptidase subunit 1(SPC1)

Recombinant Ashbya gossypii Microsomal signal peptidase subunit 1(SPC1)

SKU:CSB-CF741575DOT

Regular price €1.377,95 EUR
Regular price Sale price €1.377,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q74Z81

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSLTLYAFAAAYG LALLLVVPAYGKYRQQKLAWVGSAAATTKDL

Protein Names:Recommended name: Microsomal signal peptidase subunit 1 EC= 3.4.-.-

Gene Names:Name:SPC1 Ordered Locus Names:AGR325C

Expression Region:1-91

Sequence Info:full length protein

View full details