Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ashbya gossypii Cytochrome c oxidase subunit 2(COX2)

Recombinant Ashbya gossypii Cytochrome c oxidase subunit 2(COX2)

SKU:CSB-CF773545DOT

Regular price €1.520,95 EUR
Regular price Sale price €1.520,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q7YFV7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DVPTPYNMYFQDSTTPHQEGILELHDNIMFYMLTVLGLVSWMMIIIIKDYKNNPITYKYI KHGQMIEIIWTILPAIILLMIAFPSFILLYLCDEVISPAMTIKVIGLQWYWKYEYSDFIN DNGETIEYESYMIPEELLEEGQLRMLDTDTSIVIPVDTHVRFIVTATDVIHDFAVPSLGI KIDTTPGRLSQVSTLIQREGIFYGQCSELCGAQHSAMPIKIETVKLPTFLTWLNEQ

Protein Names:Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II

Gene Names:Name:COX2 Synonyms:CoxII Ordered Locus Names:AMI001W ORF Names:AgCOX2

Expression Region:13-248

Sequence Info:full length protein

View full details