Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aromatoleum aromaticum Probable intracellular septation protein A(AZOSEA37130)

Recombinant Aromatoleum aromaticum Probable intracellular septation protein A(AZOSEA37130)

SKU:CSB-CF702937AAAB

Regular price €1.482,95 EUR
Regular price Sale price €1.482,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))

Uniprot NO.:Q5NYM6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKILFDLLPVILFFVAYKIAGGNQAFAHELASRWLGDGIAVTQAPILLATAVAILATIAQ IGWVWMRHRKVDTMLWISLAIIAVFGGATLFFHNPTFIKWKPTALYWLFGGTLTVSAVIF RRNLIRKMLEAQIRLPEPVWKRLNLAWAGFFILMGFLNLYVAYNFSEEAWVNFKLFGGMG LMLLFVLGQGFYLSRHIQEETT

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:AZOSEA37130 ORF Names:ebA6501

Expression Region:1-202

Sequence Info:full length protein

View full details