Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arginine ABC transporter permease protein ArtQ(artQ)

Recombinant Arginine ABC transporter permease protein ArtQ(artQ)

SKU:CSB-CF365080EGX

Regular price €1.522,95 EUR
Regular price Sale price €1.522,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O6

Uniprot NO.:P0AE35

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEFFPLASAAGMTVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSALVTILRGLPEI LVVLFIYFGSSQLLLTLSDGFTINLGFVQIPVQMDIENFDVSPFLCGVIALSLLYAAYAS QTLRGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVS LISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQYILKRIDLRATRFERRPS

Protein Names:Recommended name: Arginine ABC transporter permease protein ArtQ

Gene Names:Name:artQ Ordered Locus Names:c0995

Expression Region:1-238

Sequence Info:full length protein

View full details